{"product_id":"proteintech-29803-1-ap","title":"Proteintech, 29803-1-AP, RGS12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGS12 (29803-1-AP) by Proteintech is a Polyclonal antibody targeting RGS12 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29803-1-AP targets RGS12 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A431 cells,  SH-SY5Y cells,  THP-1 cells,  NIH\/3T3 cells\nPositive IHC detected in: rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRegulator of G-protein signaling 12 (RGS12) regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. This antibody can be detected as 140-150 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30731 Product name: Recombinant human RGS12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 833-962 aa of NM_198229 Sequence: LAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKATK Predict reactive species\nFull Name: regulator of G-protein signaling 12\nCalculated Molecular Weight: 156 kDa\nObserved Molecular Weight: 140-150 kDa\nGenBank Accession Number: NM_198229\nGene Symbol: RGS12\nGene ID (NCBI): 6002\nRRID: AB_2935482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14924\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887783923881,"sku":"29803-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29803-1-ap","provider":"Iright","version":"1.0","type":"link"}