{"product_id":"proteintech-29804-1-ap","title":"Proteintech, 29804-1-AP, PPP1R13B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP1R13B (29804-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R13B in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n29804-1-AP targets PPP1R13B in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells\nPositive IHC detected in: human lung cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPP1R13B(Protein phosphatase 1 regulatory subunit 13B), also named ASPP1 and KIAA0771, is a member of the apoptosis-stimulating proteins of the p53 family (ASPPs)(PMID: 30908929). PPP1R13B contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. PPP1R13 promotes DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30788 Product name: Recombinant human PPP1R13B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 730-887 aa of BC136527 Sequence: FNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEAPSPGEEQVPPAPLPPASHPPATSTNKRTNLKKPNSERTGHGLRVRFN Predict reactive species\nFull Name: protein phosphatase 1, regulatory (inhibitor) subunit 13B\nCalculated Molecular Weight: 1090 aa, 120 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC136527\nGene Symbol: PPP1R13B\nGene ID (NCBI): 23368\nRRID: AB_2923610\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96KQ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869735080105,"sku":"29804-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29804-1-ap","provider":"Iright","version":"1.0","type":"link"}