{"product_id":"proteintech-29809-1-ap","title":"Proteintech, 29809-1-AP, CAPN5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAPN5 (29809-1-AP) by Proteintech is a Polyclonal antibody targeting CAPN5 in WB, ELISA applications with reactivity to Human, Mouse samples\n29809-1-AP targets CAPN5 in WB, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, A431 cells,  mouse colon tissue,  A549 cells,  HEK-293 cells,  HeLa cells,  HepG2 cells,  SH-SY5Y cells,  SKOV-3 cells,  Y79 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalpain-5 is a protein that in humans is encoded by the CAPN5 gene. Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subunits. Unlike some of the calpains, CAPN5 and CAPN6 lack a calmodulin-like domain IV. Because of the significant similarity to Caenorhabditis elegans sex determination gene tra-3, CAPN5 is also called HTRA3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30479 Product name: Recombinant human CAPN5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-105 aa of BC018123 Sequence: MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWK Predict reactive species\nFull Name: calpain 5\nCalculated Molecular Weight: 640 aa, 73 kDa\nObserved Molecular Weight: 65-73 kDa\nGenBank Accession Number: BC018123\nGene Symbol: CAPN5\nGene ID (NCBI): 726\nRRID: AB_3086169\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15484\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885798281385,"sku":"29809-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29809-1-ap","provider":"Iright","version":"1.0","type":"link"}