{"product_id":"proteintech-29844-1-ap","title":"Proteintech, 29844-1-AP, VPS13C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS13C (29844-1-AP) by Proteintech is a Polyclonal antibody targeting VPS13C in WB, ELISA applications with reactivity to human, mouse samples\n29844-1-AP targets VPS13C in WB, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPS13C (vacuolar protein sorting 13 homolog C) acts at membrane contact sites between intracellular organelles to transport lipids.  There are four VPS13 family members in human - VPS13A, VPS13B, VPS13C, and VPS13D. Mutations in human VPS13 genes are linked to rare neurodegenerative disorders: chorea- acanthocytosis (VPS13A), Cohen syndrome (VPS13B), predispose to early onset into Parkinson's disease (VPS13C) and lead to ataxia\/spastic paraplegia (VPS13D) (PMID: 30656912).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31069 Product name: Recombinant human VPS13C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-253 aa of NM_017684 Sequence: SIKYDAVKEEKSLQDVKQKELSRIEEALQKAAEKGTHSGEFIYGLENFVYKDIKPGRKRKKHKKHFKKPFKGLDRSKDKPKEAKKDTFVEKLATQVIKNVQVKITDIHIKYEDDVTDPKRPLSFGVTLGELSLLTANEHWTPCILNEADKIIYKLIRLD Predict reactive species\nFull Name: vacuolar protein sorting 13 homolog C (S. cerevisiae)\nCalculated Molecular Weight: 422 kDa\nObserved Molecular Weight: 422 kDa\nGenBank Accession Number: NM_017684\nGene Symbol: VPS13C\nGene ID (NCBI): 54832\nRRID: AB_3086177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q709C8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869627109545,"sku":"29844-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29844-1-ap","provider":"Iright","version":"1.0","type":"link"}