{"product_id":"proteintech-29848-1-ap","title":"Proteintech, 29848-1-AP, BNIP3L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BNIP3L (29848-1-AP) by Proteintech is a Polyclonal antibody targeting BNIP3L in WB, ELISA applications with reactivity to human samples\n29848-1-AP targets BNIP3L in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  mouse brain cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBNIP3L (also known as NIX) is a mitochondrial outer-membrane protein that belongs to the BH3-only subgroup of the BCL-2 family. Initially identified as a weak pro-apoptotic factor, it has emerged as a key mitophagy receptor that bridges damaged or surplus mitochondria to the autophagosome, thereby safeguarding mitochondrial quality and cellular homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31514 Product name: Recombinant human BNIP3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-146 aa of BC001559 Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS Predict reactive species\nFull Name: BCL2\/adenovirus E1B 19kDa interacting protein 3-like\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC001559\nGene Symbol: BNIP3L\nGene ID (NCBI): 665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60238\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885261279401,"sku":"29848-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29848-1-ap","provider":"Iright","version":"1.0","type":"link"}