{"product_id":"proteintech-29885-1-ap","title":"Proteintech, 29885-1-AP, MGC33407\/ACTL9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MGC33407\/ACTL9 (29885-1-AP) by Proteintech is a Polyclonal antibody targeting MGC33407\/ACTL9 in WB, IHC, IF-P, ELISA applications with reactivity to human,  mouse,  rat samples\n29885-1-AP targets MGC33407\/ACTL9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle\nPositive IHC detected in: human liver tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACTL9 (Actin Like 9), also named MGC33407, encodes a testis-specific actin-like protein that plays a role in fusion of proacrosomal vesicles and perinuclear theca formation (PMID: 33626338). ACTL9 protein contains 416 amino acids, which mainly localizes in the equatorial segment of human sperm head (PubMed: 33626338). Diseases associated with ACTL9 include spermatogenic failure and non-syndromic male infertility.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31805 Product name: Recombinant human MGC33407 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-172 aa of BC024028 Sequence: MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDSPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPELTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAFESLRS Predict reactive species\nFull Name: hypothetical protein MGC33407\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC024028\nGene Symbol: ACTL9\nGene ID (NCBI): 284382\nRRID: AB_2923617\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TC94\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887719010473,"sku":"29885-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29885-1-ap","provider":"Iright","version":"1.0","type":"link"}