{"product_id":"proteintech-29904-1-ap","title":"Proteintech, 29904-1-AP, TPH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPH1 (29904-1-AP) by Proteintech is a Polyclonal antibody targeting TPH1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n29904-1-AP targets TPH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTryptophan hydroxylase 1 (TPH1) is the rate-limiting enzyme in the synthesis of serotonin (5-HT) from the amino acid tryptophan. It is primarily found in peripheral tissues such as the gut, pineal gland, and spleen. TPH1 plays a crucial role in regulating peripheral serotonin levels, which are involved in various physiological processes including gastrointestinal motility and cardiovascular function. Additionally, TPH1 has been implicated in the regulation of blood glucose levels and is associated with conditions such as fatty liver disease. (PMID: 32590025, PMID: 36331742, PMID: 37652099)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31623 Product name: Recombinant human TPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 385-444 aa of BC106739 Sequence: KMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI Predict reactive species\nFull Name: tryptophan hydroxylase 1\nCalculated Molecular Weight: 466 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC106739\nGene Symbol: TPH1\nGene ID (NCBI): 7166\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17752\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887835893929,"sku":"29904-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29904-1-ap","provider":"Iright","version":"1.0","type":"link"}