{"product_id":"proteintech-29911-1-ap","title":"Proteintech, 29911-1-AP, Kindlin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Kindlin 2 (29911-1-AP) by Proteintech is a Polyclonal antibody targeting Kindlin 2 in WB, IHC, ELISA applications with reactivity to human samples\n29911-1-AP targets Kindlin 2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells\nPositive IHC detected in: human lung cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFERMT2, also named as KIND2, MIG2, PLEKHC1, MIG-2 and Kindlin-2, belongs to the kindlin family. There are three FERMT2 isoforms that participate in the connection between extracellular matrix (ECM) adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. FERMT2 recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites.  Variable expression in human cancers and  mesenchymal cancer invasion are now linked with FERMT2, which may plays important role in carcinormas development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31795 Product name: Recombinant human Kindlin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-441 aa of BC017327 Sequence: TSENHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNI Predict reactive species\nFull Name: fermitin family homolog 2 (Drosophila)\nCalculated Molecular Weight: 680 aa, 78 kDa\nObserved Molecular Weight: 78 kDa\nGenBank Accession Number: BC017327\nGene Symbol: Kindlin 2\nGene ID (NCBI): 10979\nRRID: AB_3086186\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96AC1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696400553,"sku":"29911-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29911-1-ap","provider":"Iright","version":"1.0","type":"link"}