{"product_id":"proteintech-29928-1-ap","title":"Proteintech, 29928-1-AP, M-cadherin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe M-cadherin (29928-1-AP) by Proteintech is a Polyclonal antibody targeting M-cadherin in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n29928-1-AP targets M-cadherin in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. M-cadherin (muscle cadherin), also known as CDH15 (cadherin-15), is a 124-kDa type I transmembrane glycoprotein that is highly expressed in developing skeletal muscle, satellite cells, and cerebellum (PMID: 9545347; 12052883). It associates with β-catenin and functions as a cell-cell adhesion molecule in a homophilic and specific manner (PMID: 9545347). M-cadherin is part of the myogenic program and may provide a trigger for terminal muscle differentiation (PMID: 1840697).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25763 Product name: Recombinant human CDH15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-450 aa of BC008951 Sequence: AFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVEDRDLPGSPNWVARFTILEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYR Predict reactive species\nFull Name: cadherin 15, type 1, M-cadherin (myotubule)\nCalculated Molecular Weight: 89 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC008951\nGene Symbol: M-cadherin\nGene ID (NCBI): 1013\nRRID: AB_3086192\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55291\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887714685097,"sku":"29928-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29928-1-ap","provider":"Iright","version":"1.0","type":"link"}