{"product_id":"proteintech-29938-1-ap","title":"Proteintech, 29938-1-AP, DOCK5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DOCK5 (29938-1-AP) by Proteintech is a Polyclonal antibody targeting DOCK5 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n29938-1-AP targets DOCK5 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, Jurkat cells,  A549 cells,  DU 145 cells,  NIH3T3 cells,  rat brain tissue,  NIH\/3T3 cells,  mouse brain tissue\nPositive IP detected in: DU 145 cells\nPositive IHC detected in: mouse kidney tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDOCK5 is a member of the dedicator of cytokinesis protein family. Members of this family act as guanine nucleotide exchange factors for small Rho family G proteins. DOCK5 is thought to associate with adaptors CRK and CRKL, and function in regulation of intestinal epithelial cell spreading and migration on collagen IV.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32193 Product name: Recombinant human DOCK5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1700-1870 aa of BC137175 Sequence: ILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKAQRPKSLQLMDNRLSPFHGSSPPQSTPLSPPPLTPKATRTLSSPSLQTDGIAATPVPPPPPPKSKPYEGSQRNSTELAPPLPVRREAKAPPPPPPKARKSGIPTSEPGSQ Predict reactive species\nFull Name: dedicator of cytokinesis 5\nCalculated Molecular Weight: 1870 aa, 215 kDa\nObserved Molecular Weight: 190 kDa\nGenBank Accession Number: BC137175\nGene Symbol: DOCK5\nGene ID (NCBI): 80005\nRRID: AB_3086194\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H7D0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887292600489,"sku":"29938-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29938-1-ap","provider":"Iright","version":"1.0","type":"link"}