{"product_id":"proteintech-29954-1-ap","title":"Proteintech, 29954-1-AP, PER2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PER2 (29954-1-AP) by Proteintech is a Polyclonal antibody targeting PER2 in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n29954-1-AP targets PER2 in WB, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HeLa cells\nPositive IF\/ICC detected in: MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774). 29954-1-AP detected molecular weight of 45 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31471 Product name: Recombinant human PER2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_022817 Sequence: MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKA Predict reactive species\nFull Name: period homolog 2 (Drosophila)\nCalculated Molecular Weight: 137KD\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_022817\nGene Symbol: PER2\nGene ID (NCBI): 8864\nRRID: AB_3086198\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15055\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869726527657,"sku":"29954-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29954-1-ap","provider":"Iright","version":"1.0","type":"link"}