{"product_id":"proteintech-29985-1-ap","title":"Proteintech, 29985-1-AP, MLK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MLK2 (29985-1-AP) by Proteintech is a Polyclonal antibody targeting MLK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29985-1-AP targets MLK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP3K10, also named as MLK2 and MST, belongs to the protein kinase superfamily, STE Ser\/Thr protein kinase family and MAP kinase kinase kinase subfamily. MAP3K10 activates the JUN N-terminal pathway. MAP3K10 catalyzes the reaction: ATP + a protein = ADP + a phosphoprotein. MAP3K10 can be detected 104-115 kDa by phosphorylation (PMID: 23178452).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32419 Product name: Recombinant human MAP3K10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-620 aa of NM_002446 Sequence: LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHTPIAPGFASLNEMEEFAEAED Predict reactive species\nFull Name: mitogen-activated protein kinase kinase kinase 10\nCalculated Molecular Weight: 104KD\nObserved Molecular Weight: 104-115 kDa\nGenBank Accession Number: NM_002446\nGene Symbol: MAP3K10\nGene ID (NCBI): 4294\nRRID: AB_3086204\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02779\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869710536873,"sku":"29985-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-29985-1-ap","provider":"Iright","version":"1.0","type":"link"}