{"product_id":"proteintech-30018-1-ap","title":"Proteintech, 30018-1-AP, ZNF643 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF643 (30018-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF643 in WB, ELISA applications with reactivity to human samples\n30018-1-AP targets ZNF643 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HuH-7 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF643 (Zinc finger protein 643) is also named as ZFP69B. ZNF643, a putative transcription factor gene, is situated next to ZFP69, which has been linked to pathogenesis of human diabetes, as its allelic variation associates with impaired lipid storage in white adipose tissue (PMID: 19578398). It may be involved in transcriptional regulation, and is essential for Golgi structural integrity (PMID:29851555). ZNF643 has two isoforms with molecular weights of 50 kDa and 62 kDa. ZNF643 is modified by SUMO.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32346 Product name: Recombinant human ZNF643 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 48-180 aa of BC017498 Sequence: KTKTKESALQNDISWEELHCGLMMERFTKGSSMYSTLGRISKCNKLESQQENQRMGKGQIPLMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYTKMKTFECN Predict reactive species\nFull Name: zinc finger protein 643\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC017498\nGene Symbol: ZNF643\nGene ID (NCBI): 65243\nRRID: AB_3086212\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJL9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887951696041,"sku":"30018-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30018-1-ap","provider":"Iright","version":"1.0","type":"link"}