{"product_id":"proteintech-30058-1-ap","title":"Proteintech, 30058-1-AP, ULBP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ULBP3 (30058-1-AP) by Proteintech is a Polyclonal antibody targeting ULBP3 in WB, ELISA applications with reactivity to Human samples\n30058-1-AP targets ULBP3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MDA-MB-231 cells,  SW480 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nULBP3 (UL16 binding protein-3), a class 1 major histocompatibility complex-like (MHC-like) molecule and member of the family of ligands of the killer cell lectin-like receptor subfamily K member 1 (NKG2D) (PMID:31292299). ULBP3 are expressed at the cell surface of multiple types of cells and tissues as a glycosylphosphatidylinositol (GPI)-linked proteins (PMID:22741585).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32424 Product name: Recombinant human ULBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-150 aa of Sequence: DAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFL Predict reactive species\nFull Name: UL16 binding protein 3\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGene Symbol: ULBP3\nGene ID (NCBI): 79465\nRRID: AB_3086222\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZM4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887917060265,"sku":"30058-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30058-1-ap","provider":"Iright","version":"1.0","type":"link"}