{"product_id":"proteintech-30070-1-ap","title":"Proteintech, 30070-1-AP, PPP1CC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP1CC (30070-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1CC in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30070-1-AP targets PPP1CC in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPP1CC, also named as PP-1G, belongs to the PPP phosphatase family and PP-1 subfamily.  Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. It is involved in regulation of ionic conductances and long-term synaptic plasticity. PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+\/calmodulin dependent protein kinase II.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32348 Product name: Recombinant human PPP1CC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-323 aa of BC014073 Sequence: WSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK Predict reactive species\nFull Name: protein phosphatase 1, catalytic subunit, gamma isoform\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC014073\nGene Symbol: PPP1CC\nGene ID (NCBI): 5501\nRRID: AB_3086223\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36873\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887769931945,"sku":"30070-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30070-1-ap","provider":"Iright","version":"1.0","type":"link"}