{"product_id":"proteintech-30081-1-ap","title":"Proteintech, 30081-1-AP, MCCC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MCCC1 (30081-1-AP) by Proteintech is a Polyclonal antibody targeting MCCC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30081-1-AP targets MCCC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse brain tissue,  mouse heart tissue,  rat brain tissue\nPositive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMCCC1 is the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32459 Product name: Recombinant human MCCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-200 aa of BC004187 Sequence: TTATGRNITKVLIANRGEIACRVMRTAKKLGVQTVAVYSEADRNSMHVDMADEAYSIGPAPSQQSYLSMEKIIQVAKTSAAQAIHPGCGFLSENMEFAELCKQEGIIFIGPPPSAIRDMGIKSTSKSIMAAAGVPVVEGYHGEDQSDQCLKEHARRIGY Predict reactive species\nFull Name: methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)\nCalculated Molecular Weight: 76 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC004187\nGene Symbol: MCCC1\nGene ID (NCBI): 56922\nRRID: AB_3086226\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96RQ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887714783401,"sku":"30081-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30081-1-ap","provider":"Iright","version":"1.0","type":"link"}