{"product_id":"proteintech-30117-1-ap","title":"Proteintech, 30117-1-AP, TGFBR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TGFBR1 (30117-1-AP) by Proteintech is a Polyclonal antibody targeting TGFBR1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n30117-1-AP targets TGFBR1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MDA-MB-231 cells,  NCI-H1299 cells,  U-87 MG cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse ovary tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTGFBR1 (TGF-beta receptor type-1) encodes a serine\/threonine kinase receptor for transforming growth factor-beta. TGFB1, TGFB2 and TGFB3 signals are transduced from the cell surface to the cytoplasm and regulate lots of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Mutations in both TGFBR2 and TGFBR1 were associated with early onset and aggressive thoracic aortic disease with MFS-like skeletal features, but also hypertelorism, craniosynostosis, developmental delay, cleft palate and bifid uvula, congenital heart disease and aneurysms, and dissections throughout the arterial tree with marked arterial tortuosity (PMID: 15731757, PMID: 27879313).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31620 Product name: Recombinant human TGFBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-180 aa of NM_004612 Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL Predict reactive species\nFull Name: transforming growth factor, beta receptor 1\nCalculated Molecular Weight: 56KD\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: NM_004612\nGene Symbol: TGFBR1\nGene ID (NCBI): 7046\nRRID: AB_3086235\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36897\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921647273,"sku":"30117-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30117-1-ap","provider":"Iright","version":"1.0","type":"link"}