{"product_id":"proteintech-30146-1-ap","title":"Proteintech, 30146-1-AP, SEPT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEPT3 (30146-1-AP) by Proteintech is a Polyclonal antibody targeting SEPT3 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n30146-1-AP targets SEPT3 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEPT3 is a developmentally regulated phosphoprotein. SEPT3 is a member of the septin GTPase family, which can form polymers and contribute to the cytoskeleton. SEPT3 is involved in neuronal autophagy. In the process of autophagy regulation, the level of SEPT3 will change according to the autophagy protein. SEPT3 is specifically expressed in the brain (PMID: 15485489; 35932293).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32890 Product name: Recombinant human SEPT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 264-345 aa of BC111779 Sequence: VLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE Predict reactive species\nFull Name: septin 3\nCalculated Molecular Weight: 358 aa, 41 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC111779\nGene Symbol: SEPT3\nGene ID (NCBI): 55964\nRRID: AB_2935520\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UH03\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887796637865,"sku":"30146-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30146-1-ap","provider":"Iright","version":"1.0","type":"link"}