{"product_id":"proteintech-30148-1-ap","title":"Proteintech, 30148-1-AP, GGT5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GGT5 (30148-1-AP) by Proteintech is a Polyclonal antibody targeting GGT5 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30148-1-AP targets GGT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 3T3-L1 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGamma-glutamyltransferase 5 (GGT5) is one of the two GGT family members (GGT1 and GGT5) with catalytic activity identified to date and was first reported in 2008 (PMID:18357469). GGT5 is widely distributed in a variety of tissues, with relatively high expression in liver, kidney, and alveolar macrophages (PMID:25377544). GGT5 played a pivotal role in oxidative regulation, drug metabolism, and immune modulation in the human body (PMID:21447318).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32373 Product name: Recombinant human GGT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 387-527 aa of BC011362 Sequence: GTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSK Predict reactive species\nFull Name: gamma-glutamyltransferase 5\nCalculated Molecular Weight: 586 aa, 62 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC011362\nGene Symbol: GGT5\nGene ID (NCBI): 2687\nRRID: AB_3086247\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36269\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887650558121,"sku":"30148-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30148-1-ap","provider":"Iright","version":"1.0","type":"link"}