{"product_id":"proteintech-30152-1-ap","title":"Proteintech, 30152-1-AP, ISM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ISM1 (30152-1-AP) by Proteintech is a Polyclonal antibody targeting ISM1 in WB, ELISA applications with reactivity to Human samples\n30152-1-AP targets ISM1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, TT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nISM1, also known as C20orf82. It is expected to be located in extracellular space, and the protein is enriched in the thyroid gland tissue. Acts as an angiogenesis inhibitor. The protein is predicted to be involved in negative regulation of angiogenesis. Since the molecular weight of the detected ISM1 was larger than expected (52 kD), ISM1 is likely subject to posttranslational modifications. Glycosylation is commonly found in many secreted proteins, and analysis of the ISM1 protein sequence predicted two putative N-glycosylation sites at positions N39 and N282. (PMID: 31171630)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32761 Product name: Recombinant human ISM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-228 aa of NM_080826 Sequence: ADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSKEAPREHLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADINGQNPNIQVTIEVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKYDSTSDDSNFLNPPRGWDHTAPGHRTFETKDQPEYDSTDGEGDWSLWSV Predict reactive species\nFull Name: isthmin 1 homolog (zebrafish)\nCalculated Molecular Weight: 52kd\nObserved Molecular Weight: 52 kDa, 70 kDa\nGenBank Accession Number: NM_080826\nGene Symbol: ISM1\nGene ID (NCBI): 140862\nRRID: AB_3669703\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: B1AKI9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887687127209,"sku":"30152-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30152-1-ap","provider":"Iright","version":"1.0","type":"link"}