{"product_id":"proteintech-30182-1-ap","title":"Proteintech, 30182-1-AP, Ribosomal protein L4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ribosomal protein L4 (30182-1-AP) by Proteintech is a Polyclonal antibody targeting Ribosomal protein L4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n30182-1-AP targets Ribosomal protein L4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\n60S ribosomal protein L4 is encoded by RPL4 (or RPL1) gene. RPL4 is a component of 60S subunit of ribosome, and belongs to the L4E family. By interacting with c-Myb, RPL4 plays a important role in c-myc expression in response to growth factor and nutritional signals. Recently RPL4 was reported to be able to increase effeiciency of viral recoding sequence.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32272 Product name: Recombinant human RPL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-340 aa of BC009888 Sequence: HQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTI Predict reactive species\nFull Name: ribosomal protein L4\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC009888\nGene Symbol: Ribosomal protein L4\nGene ID (NCBI): 6124\nRRID: AB_3086255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36578\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887784775849,"sku":"30182-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30182-1-ap","provider":"Iright","version":"1.0","type":"link"}