{"product_id":"proteintech-30190-1-ap","title":"Proteintech, 30190-1-AP, FATS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FATS (30190-1-AP) by Proteintech is a Polyclonal antibody targeting FATS in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n30190-1-AP targets FATS in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse liver tissue,  rat brain tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFATS, also known as centrosomal protein C10orf90, bA422P15.2, belongs to a novel class of enzymes that acts as an E2-E3 hybrid enzyme for assembly of polyubiquitin chains. FATS is an E2-independent ubiquitin ligase that stabilizes p53 and promotes its activation in response to DNA damage (PMID: 24240685). FATS acts as a p53\/TP53 activator by inhibiting MDM2 binding to p53\/TP53 and stimulating non-proteolytic polyubiquitination of p53\/TP53.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32956 Product name: Recombinant human C10orf90 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 169-400 aa of NM_001004298.2 Sequence: AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGACPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHA Predict reactive species\nFull Name: chromosome 10 open reading frame 90\nCalculated Molecular Weight: 78 kDa\nObserved Molecular Weight: 67-77 kDa\nGenBank Accession Number: NM_001004298.2\nGene Symbol: FATS\/C10orf90\nGene ID (NCBI): 118611\nRRID: AB_2935528\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96M02\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887635746985,"sku":"30190-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30190-1-ap","provider":"Iright","version":"1.0","type":"link"}