{"product_id":"proteintech-30197-1-ap","title":"Proteintech, 30197-1-AP, SMPD1,ASM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMPD1,ASM (30197-1-AP) by Proteintech is a Polyclonal antibody targeting SMPD1,ASM in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30197-1-AP targets SMPD1,ASM in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMPD1(Sphingomyelin phosphodiesterase) is also named as ASM and belongs to the acid sphingomyelinase family. It is an important enzyme in sphingolipid metabolism and plays key roles in apoptosis, immunity, development, and cancer. The deficient activity of this enzyme results in Types A and B Niemann-Pick disease (NPD). This protein has 4 isoforms produced by alternative splicing. SMPD1 can produce a 60 kDa peptide with its signal peptide missing. As a catalytically inactive 75kDa precursor, after signal peptide cleavage, it was processed into smaller non-glycosylated and rapidly degraded 57kDa form in ER-Golgi complex. And 70kDa mature form with major catalytic activity located in lysosomes, which is further processed into 52kDa form (PMID:25853898, PMID:26499107).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32479 Product name: Recombinant human SMPD1,ASM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 48-230 aa of BC041164 Sequence: SDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRG Predict reactive species\nFull Name: sphingomyelin phosphodiesterase 1, acid lysosomal\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 68-70 kDa\nGenBank Accession Number: BC041164\nGene Symbol: SMPD1\nGene ID (NCBI): 6609\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17405\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887810072745,"sku":"30197-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30197-1-ap","provider":"Iright","version":"1.0","type":"link"}