{"product_id":"proteintech-30211-1-ap","title":"Proteintech, 30211-1-AP, SLC7A8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC7A8 (30211-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A8 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30211-1-AP targets SLC7A8 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, JAR cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSolute carrier family 7 member 8 (SLC7A8), also known as LAT2, is an amino acid transporter that, together with LAT1 (SLC7A5), facilitates the bidirectional transport of branched-chain and aromatic AAs across the plasma membrane.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32957 Product name: Recombinant human SLC7A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 468-535 aa of Sequence: YWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP Predict reactive species\nFull Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 8\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 45-50 kDa\nGene Symbol: SLC7A8\nGene ID (NCBI): 23428\nRRID: AB_3086264\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHI5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887807975593,"sku":"30211-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30211-1-ap","provider":"Iright","version":"1.0","type":"link"}