{"product_id":"proteintech-30212-1-ap","title":"Proteintech, 30212-1-AP, BRAWNIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRAWNIN (30212-1-AP) by Proteintech is a Polyclonal antibody targeting BRAWNIN in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n30212-1-AP targets BRAWNIN in WB, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, MCF-7 cells\nPositive IF\/ICC detected in: U-251 cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:400-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquinol-cytochrome-c reductase complex assembly factor 6 (UQCC6) is also named as BRAWNIN, BR and C12orf73, and belongs to the UQCC6 family. BRAWNIN (BR), a 71 a.a. peptide encoded by C12orf73, is essential for respiratory chain complex III (CIII) assembly. In human cells, BRAWNIN is induced by the energy-sensing AMPK pathway, and its depletion impairs mitochondrial ATP production. In zebrafish, Brawnin deletion causes complete CIII loss, resulting in severe growth retardation, lactic acidosis and early death (PMID:32161263).  BR is also detectable in human cardiac and skeletal muscle where it displays a staining pattern characteristic of the mitochondria network. BR protein abundance in mouse tissues correlated well with that of mitochondrial respiratory chain proteins, being high in brown adipose, cardiac and skeletal muscle but virtually undetectable in white adipose tissue (PMID:32161263). BR resides in the IMM and not in the outer mitochondrial membrane (OMM)  (PMID:32161263).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32955 Product name: Recombinant human BRAWNIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-71 aa of Sequence: EVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEELK Predict reactive species\nFull Name: chromosome 12 open reading frame 73\nCalculated Molecular Weight: 8 kDa\nObserved Molecular Weight: 9 kDa\nGene Symbol: C12orf73\nGene ID (NCBI): 728568\nRRID: AB_3086265\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q69YU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885277991081,"sku":"30212-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30212-1-ap","provider":"Iright","version":"1.0","type":"link"}