{"product_id":"proteintech-30215-1-ap","title":"Proteintech, 30215-1-AP, TBXAS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TBXAS1 (30215-1-AP) by Proteintech is a Polyclonal antibody targeting TBXAS1 in WB, IHC, ELISA applications with reactivity to human samples\n30215-1-AP targets TBXAS1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, THP-1 cells\nPositive IHC detected in: human ovary cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTBXAS1 catalyzes the conversion of the prostaglandin endoperoxide into thromboxane A2 as a potent vasoconstrictor and inducer of platelet aggregation. It was identified as a novel airway fibroblast-specific marker with integrin-8 (ITGA8) (PMID:20435685). It was observed in the epithelium. It is a monomer with a molecular weight of 60 kDa. It also has two variants with 60.5 kDa and 52.3 kDa (PMID:1730669).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30950 Product name: Recombinant human TBXAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-267 aa of BC014117 Sequence: NKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQ Predict reactive species\nFull Name: thromboxane A synthase 1 (platelet)\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC014117\nGene Symbol: TBXAS1\nGene ID (NCBI): 6916\nRRID: AB_3086266\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24557\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887824392361,"sku":"30215-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30215-1-ap","provider":"Iright","version":"1.0","type":"link"}