{"product_id":"proteintech-30227-1-ap","title":"Proteintech, 30227-1-AP, WDR43 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR43 (30227-1-AP) by Proteintech is a Polyclonal antibody targeting WDR43 in WB, IHC, ELISA applications with reactivity to human samples\n30227-1-AP targets WDR43 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HeLa cells,  HepG2 cells,  Jurkat cells\nPositive IHC detected in: mouse lung tissue, mouse ovary tissue,  rat liver tissue,  rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR43, a WD40 domain-containing protein, is a conserved component of the small-subunit processome (SSUP), which mediates pre-18S ribosomal RNA (rRNA) transcription and processing in the nucleolus and is critical for ribosome biogenesis in yeast. Its mutation in zebrafish causes a variety of early developmental defects in specific tissues. WDR43 directly promotes ESC self-renewal by maintaining high-level expression of its target genes involved in pluripotency programs. (PMID: 28880863, 24497835, 31128943)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30585 Product name: Recombinant human WDR43 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-150 aa of NM_015131 Sequence: MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPARLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDSGCLYSCSDDKHI Predict reactive species\nFull Name: WD repeat domain 43\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: NM_015131\nGene Symbol: WDR43\nGene ID (NCBI): 23160\nRRID: AB_3086268\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15061\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869793276073,"sku":"30227-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30227-1-ap","provider":"Iright","version":"1.0","type":"link"}