{"product_id":"proteintech-30232-1-ap","title":"Proteintech, 30232-1-AP, SLC7A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC7A2 (30232-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n30232-1-AP targets SLC7A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSolute carrier family 7 member 2 (SLC7A2), also known as CAT2, is a member of the solute carrier superfamily. It functions as a cationic amino acid transporter, which can transport cationic amino acids (arginine, lysine and ornithine) into the cytosol and regulate inflammation (PMID: 35152203). It has been shown that lower SLC7A2 expression is associated with worse prognosis of ovarian cancer and hepatocellular carcinoma (PMID: 34108444; 32647070), and SLC7A2 deficiency in inflammatory bowel tissues increases the risk of inflammation-associated colon tumorigenesis (PMID: 30202097)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31207 Product name: Recombinant human SLC7A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 568-657 aa of BC104905 Sequence: ILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSYGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHEKTSEF Predict reactive species\nFull Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 2\nCalculated Molecular Weight: 698 aa, 76 kDa\nObserved Molecular Weight: 76 kDa\nGenBank Accession Number: BC104905\nGene Symbol: SLC7A2\nGene ID (NCBI): 6542\nRRID: AB_3086271\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52569\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869766701225,"sku":"30232-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30232-1-ap","provider":"Iright","version":"1.0","type":"link"}