{"product_id":"proteintech-30236-1-ap","title":"Proteintech, 30236-1-AP, QRICH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe QRICH1 (30236-1-AP) by Proteintech is a Polyclonal antibody targeting QRICH1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30236-1-AP targets QRICH1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, Jurkat cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse testis tissue, rat brain tissue,  human colon cancer tissue,  human lung cancer tissue,  mouse brain tissue,  mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlutamine-rich protein 1 (QRICH1) is a transcriptional regulator that acts as a mediator of the integrated stress response (ISR) through transcriptional control of protein homeostasis under conditions of ER stress (PMID:33384352). QRICH1 is a member of the caspase recruitment domain (CARD)-containing gene family, which encodes for proteins implicated in regulation of caspase activation in the context of apoptosis and inflammation, and in regulation of NF-κB signaling(PMID:33384352). QRICH1 can be modified by phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31997 Product name: Recombinant human QRICH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC110855 Sequence: MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQLSPQLTVHQPTEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQIQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTASVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATGT Predict reactive species\nFull Name: glutamine-rich 1\nObserved Molecular Weight: 85-110 kDa\nGenBank Accession Number: BC110855\nGene Symbol: QRICH1\nGene ID (NCBI): 54870\nRRID: AB_3086273\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2TAL8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887777960105,"sku":"30236-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30236-1-ap","provider":"Iright","version":"1.0","type":"link"}