{"product_id":"proteintech-30243-1-ap","title":"Proteintech, 30243-1-AP, YIPF6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YIPF6 (30243-1-AP) by Proteintech is a Polyclonal antibody targeting YIPF6 in WB, ELISA applications with reactivity to human, mouse samples\n30243-1-AP targets YIPF6 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYIPF6 encodes a Golgi- and ER-localized membrane protein that regulates vesicle trafficking and secretory pathway integrity through interaction with Rab GTPases. Highly expressed in intestinal epithelium and immune tissues, YIPF6 is essential for Paneth and goblet cell granule maturation and mucosal immune homeostasis. Loss of YIPF6 disrupts epithelial secretion and predisposes to inflammatory bowel-like disease, establishing it as a critical regulator of Golgi function and gut barrier defense.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32477 Product name: Recombinant human YIPF6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-84 aa of BC012469 Sequence: AEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVGKKFMHVLYPRKSNT Predict reactive species\nFull Name: Yip1 domain family, member 6\nCalculated Molecular Weight: 236 aa, 26 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC012469\nGene Symbol: YIPF6\nGene ID (NCBI): 286451\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96EC8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887925973161,"sku":"30243-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30243-1-ap","provider":"Iright","version":"1.0","type":"link"}