{"product_id":"proteintech-30249-1-ap","title":"Proteintech, 30249-1-AP, Selenoprotein P Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Selenoprotein P (30249-1-AP) by Proteintech is a Polyclonal antibody targeting Selenoprotein P in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n30249-1-AP targets Selenoprotein P in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSelenoprotein P, also known as SEPP1, is expressed in the liver and heart and secreted into the plasma(PMID: 8421687). Selenoprotein P is implicated as an extracellular antioxidant involved in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2) and provides selenium to tissues such as brain and testis. In humans, it exists in plasma as two isoforms of approximately 50 and 60 kDa(PMID:19453253). Selenoprotein P is a glycosylated protein and deglycosylation of SEPP1 results in 45 kDa and 35 kDa isoforms(PMID: 25298198).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32952 Product name: Recombinant human Selenoprotein P protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-299 aa of NM_001085486.2 Sequence: SNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRS Predict reactive species\nFull Name: selenoprotein P, plasma, 1\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: NM_001085486.2\nGene Symbol: Selenoprotein P\nGene ID (NCBI): 6414\nRRID: AB_3086280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49908\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869761753257,"sku":"30249-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30249-1-ap","provider":"Iright","version":"1.0","type":"link"}