{"product_id":"proteintech-30297-1-ap","title":"Proteintech, 30297-1-AP, FLT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FLT3 (30297-1-AP) by Proteintech is a Polyclonal antibody targeting FLT3 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n30297-1-AP targets FLT3 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive IP detected in: THP-1 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFLT3 (also known as CD135 or FLK2) is a tyrosine-protein kinase that acts as a cell-surface receptor for the cytokine FLT3LG and regulates differentiation, proliferation, and survival of hematopoietic progenitor cells and of dendritic cells. FLT3 was originally identified by its expression in hematopoietic stem\/progenitor cells (PMID: 7507245). It is important for the normal development of hematopoietic stem\/progenitor cells. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32898 Product name: Recombinant human FLT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 683-810 aa of BC126350 Sequence: LSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHR Predict reactive species\nFull Name: fms-related tyrosine kinase 3\nCalculated Molecular Weight: 112 kDa\nObserved Molecular Weight: 130 kDa, 150 kDa\nGenBank Accession Number: BC126350\nGene Symbol: FLT3\nGene ID (NCBI): 2322\nRRID: AB_3086289\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36888\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869684256937,"sku":"30297-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30297-1-ap","provider":"Iright","version":"1.0","type":"link"}