{"product_id":"proteintech-30334-1-ap","title":"Proteintech, 30334-1-AP, ATPAF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATPAF2 (30334-1-AP) by Proteintech is a Polyclonal antibody targeting ATPAF2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30334-1-AP targets ATPAF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) also name as ATP12 and ATP12p, is an essential house keeping protein. ATPAF2 is an assembly factor for the F1 component of mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. The calculated MW is 33 kDa, 30334-1-AP can detect bands around 30 kDa and 50 kDa, the larger band may correspond to dimer or complex form. (PMID: 1826907, 11410595)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33299 Product name: Recombinant human ATPAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-190 aa of BC032126 Sequence: TEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTRE Predict reactive species\nFull Name: ATP synthase mitochondrial F1 complex assembly factor 2\nCalculated Molecular Weight: 289 aa, 33 kDa\nObserved Molecular Weight: ~30 kDa\nGenBank Accession Number: BC032126\nGene Symbol: ATPAF2\nGene ID (NCBI): 91647\nRRID: AB_3086297\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N5M1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885133615273,"sku":"30334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30334-1-ap","provider":"Iright","version":"1.0","type":"link"}