{"product_id":"proteintech-30391-1-ap","title":"Proteintech, 30391-1-AP, SYNJ2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYNJ2 (30391-1-AP) by Proteintech is a Polyclonal antibody targeting SYNJ2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30391-1-AP targets SYNJ2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSYNJ2(Synaptojanin-2) is also named as KIAA0348 and belongs to the synaptojanin family. SYNJ2 encodes an inositol polyphosphate phosphatase that functions in recycling neurotransmitter vesicles and is implicated in spermatogenesis(PMID: 24103750). This protein has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33002 Product name: Recombinant human SYNJ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 678-839 aa of BC043277 Sequence: RRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHGHKTLGHWVTISDQEKRTALQVFDPLAKT Predict reactive species\nFull Name: synaptojanin 2\nCalculated Molecular Weight: 1496 aa, 166 kDa\nObserved Molecular Weight: 143 kDa, 160 kDa\nGenBank Accession Number: BC043277\nGene Symbol: SYNJ2\nGene ID (NCBI): 8871\nRRID: AB_3086305\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15056\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887821312169,"sku":"30391-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30391-1-ap","provider":"Iright","version":"1.0","type":"link"}