{"product_id":"proteintech-30420-1-ap","title":"Proteintech, 30420-1-AP, CCR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCR2 (30420-1-AP) by Proteintech is a Polyclonal antibody targeting CCR2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30420-1-AP targets CCR2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells, K-562 cells,  THP-1 cells\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCR2 (C-C motif chemokine receptor-2), is a 42-kDa transmembrane protein highly expressed in bone marrow and lymph nodes (PMID: 16150057). It belongs to the G-protein-coupled seven-transmembrane receptor superfamily. CCR2 is the key functional receptor for MCP-1 (Monocyte chemoattractant protein-1) (PMID: 8146186). CCR2 and monocyte chemoattractant proteins (MCPs) play pivotal roles in the development of inflammatory responses and are crucial for the recruitment of immune cells to sites of inflammation. (PMID: 19441905). This antibody recognizes a homodimer consisting of its isoform1 and isoform2 (70 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33071 Product name: Recombinant human CCR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC074751 Sequence: MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA Predict reactive species\nFull Name: chemokine (C-C motif) receptor 2\nCalculated Molecular Weight: 374 aa, 42 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC074751\nGene Symbol: CCR2\nGene ID (NCBI): 729230\nRRID: AB_3669721\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41597\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869522415785,"sku":"30420-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30420-1-ap","provider":"Iright","version":"1.0","type":"link"}