{"product_id":"proteintech-30440-1-ap","title":"Proteintech, 30440-1-AP, USP6NL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP6NL (30440-1-AP) by Proteintech is a Polyclonal antibody targeting USP6NL in WB, IHC, ELISA applications with reactivity to human samples\n30440-1-AP targets USP6NL in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, HeLa cells,  SW480 cells,  Jurkat cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP6NL, also named RN-tre, is a GTPase-activating protein (GAP), which stimulates GTP hydrolysis on various members of the Rab family, thereby inhibiting endocytosis of PM receptors and retrograde Golgi transport. It is highly expressed in many cancer types and may promote the growth and proliferation of cancer cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32603 Product name: Recombinant human USP6NL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC042943 Sequence: MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPDHNVAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKGIPLQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNRTFRDHIMFRD Predict reactive species\nFull Name: USP6 N-terminal like\nCalculated Molecular Weight: 828 aa, 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC042943\nGene Symbol: USP6NL\nGene ID (NCBI): 9712\nRRID: AB_3086315\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92738\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887918928041,"sku":"30440-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30440-1-ap","provider":"Iright","version":"1.0","type":"link"}