{"product_id":"proteintech-30461-1-ap","title":"Proteintech, 30461-1-AP, CDK13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK13 (30461-1-AP) by Proteintech is a Polyclonal antibody targeting CDK13 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n30461-1-AP targets CDK13 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells,  MDA-MB-468 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin-dependent kinase 13 (CDK13) is also named as CDC2L, CDC2L5, CHED and KIAA1791, and belongs to the CMGC Ser\/Thr protein kinase family. Interestingly, in TNBC cells silencing CDK13 provokes cell death without affecting DDR genes. Like CDK12, CDK13 phosphorylates the Ser2 position of the heptad repeat in the CTD of RNA Pol II (PMID:26748711). CDK13\/CycK complex is that regulates transcription by phosphorylating serine residues at positions 5 and 2 of the heptapeptide repeats (Y-S-P-T-S-P-S) comprising the C-terminal domain (CTD) of RPB1, the largest subunit of RNA polymerase II (RNAPII). CDK13 is expressed in fetal brain, liver, and muscle, and adult whole brain, hippocampus, and bone marrow (PMID:30904094).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32897 Product name: Recombinant human CDK13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1150-1300 aa of NM_003718.4 Sequence: QESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKA Predict reactive species\nFull Name: cell division cycle 2-like 5 (cholinesterase-related cell division controller)\nCalculated Molecular Weight: 165 kDa\nObserved Molecular Weight: 170 kDa\nGenBank Accession Number: NM_003718.4\nGene Symbol: CDK13\nGene ID (NCBI): 8621\nRRID: AB_3086325\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14004\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869452292265,"sku":"30461-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30461-1-ap","provider":"Iright","version":"1.0","type":"link"}