{"product_id":"proteintech-30467-1-ap","title":"Proteintech, 30467-1-AP, ANKIB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKIB1 (30467-1-AP) by Proteintech is a Polyclonal antibody targeting ANKIB1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to Human, mouse samples\n30467-1-AP targets ANKIB1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Jurkat cells,  MCF-7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse kidney tissue, mouse placenta tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAnkyrin repeat and IBR domain-containing protein 1 (ANKIB1) is also named as KIAA1386, and belongs to the RBR family. ANKIB1 might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates. The common biomarkers found within the H and EC region of brain are ZNF621, SLC25A46, RAE1, and ANKIB1. Among these biomarkers, RAE1, ANKIB1, and SLC25A46 have been reported to be prominently involved in several neurodegenerative disorders (PMID:33878365). ANKIB1 is also found to be associated with Cerebral cavernous malformations (PMID:20798775).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33126 Product name: Recombinant human ANKIB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 870-1089 aa of NM_019004.1 Sequence: ALDEETRDFLSNEASLGAIGTSLPSRLDSVPRNTDSPRAALSSSELLELGDSLMRLGAENDPFSTDTLSSHPLSEARSDFCPSSSDPDSAGQDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSSDWLEQVHLV Predict reactive species\nFull Name: ankyrin repeat and IBR domain containing 1\nCalculated Molecular Weight: 122 kDa\nObserved Molecular Weight: 122 kDa\nGenBank Accession Number: NM_019004.1\nGene Symbol: ANKIB1\nGene ID (NCBI): 54467\nRRID: AB_3086328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P2G1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884970102953,"sku":"30467-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30467-1-ap","provider":"Iright","version":"1.0","type":"link"}