{"product_id":"proteintech-30474-1-ap","title":"Proteintech, 30474-1-AP, TOX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOX2 (30474-1-AP) by Proteintech is a Polyclonal antibody targeting TOX2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30474-1-AP targets TOX2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse liver tissue,  rat liver tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOX2 is a transcription factor belonging to the TOX (thymocyte selection-associated HMG box) family that shares a highly conserved high mobility group DNA-binding domain with the other TOX members. A previous study showed that TOX2 is preferentially expressed in human NK cells among various leukocyte populations and is required for in vitro and in vivo human NK cell differentiation from UCB-derived CD341 hematopoietic stem cells (HSCs) (PMID: 25352127).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31226 Product name: Recombinant human TOX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 303-424 aa of BC007636 Sequence: SSPDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLARTLGSKSLLPGLSASPPPPPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMALQVQL Predict reactive species\nFull Name: TOX high mobility group box family member 2\nCalculated Molecular Weight: 488 aa, 52 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC007636\nGene Symbol: TOX2\nGene ID (NCBI): 84969\nRRID: AB_3086330\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96NM4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887835533481,"sku":"30474-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30474-1-ap","provider":"Iright","version":"1.0","type":"link"}