{"product_id":"proteintech-30480-1-ap","title":"Proteintech, 30480-1-AP, CISD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CISD3 (30480-1-AP) by Proteintech is a Polyclonal antibody targeting CISD3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n30480-1-AP targets CISD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat liver tissue,  mouse liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32754 Product name: Recombinant human CISD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-127 aa of NM_001136498.1 Sequence: ARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL Predict reactive species\nFull Name: CDGSH iron sulfur domain 3\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: NM_001136498.1\nGene Symbol: CISD3\nGene ID (NCBI): 284106\nRRID: AB_3086332\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0C7P0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869656174761,"sku":"30480-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30480-1-ap","provider":"Iright","version":"1.0","type":"link"}