{"product_id":"proteintech-30481-1-ap","title":"Proteintech, 30481-1-AP, C19orf48 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C19orf48 (30481-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf48 in WB, ELISA applications with reactivity to Human samples\n30481-1-AP targets C19orf48 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChromosome 19 open reading frame 48 (C19orf48)  plays a crucial role in the development of breast cancer and the overexpression of C19orf48 correlates with poor prognosis in breast cancer. C19orf48 may act as a useful and predictive biomarker for the prognosis of breast cancer. (PMID: 38223642)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32888 Product name: Recombinant human C19orf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-58 aa of BC006151 Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR Predict reactive species\nFull Name: chromosome 19 open reading frame 48\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 12-13 kDa\nGenBank Accession Number: BC006151\nGene Symbol: C19orf48\nGene ID (NCBI): 84798\nRRID: AB_3669725\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6RUI8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885504090281,"sku":"30481-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30481-1-ap","provider":"Iright","version":"1.0","type":"link"}