{"product_id":"proteintech-30493-1-ap","title":"Proteintech, 30493-1-AP, DUSP10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUSP10 (30493-1-AP) by Proteintech is a Polyclonal antibody targeting DUSP10 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n30493-1-AP targets DUSP10 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDUSP10, also known as MKP5, is a member of the MKPs subfamily involved in cell proliferation, differentiation, and migration. DUSP10 is a dual specificity phosphatase capable of dephosphorylating both pTyr and pThr residues of activated MAPKs with different affinities. It has been shown that isoforms of the p38 and JNK subfamilies are selectively and more effectively dephosphorylated than ERK subfamily members. DUSP10 has been proposed as a target for therapeutic treatment of atherosclerosis, since DUSP10 inhibition reduces NF-κB-induced TNF-α expression and increases TGF-β1 levels in this disease (PMID: 30939861).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32718 Product name: Recombinant human DUSP10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-288 aa of BC031405 Sequence: MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSANPGSNSHPPVIATTVVSLKAANLTYMPSSSGSARSLNCGCSSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNNNENTGSLSPSSGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSL Predict reactive species\nFull Name: dual specificity phosphatase 10\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC031405\nGene Symbol: DUSP10\nGene ID (NCBI): 11221\nRRID: AB_3086335\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6W6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887350173865,"sku":"30493-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30493-1-ap","provider":"Iright","version":"1.0","type":"link"}