{"product_id":"proteintech-30516-1-ap","title":"Proteintech, 30516-1-AP, STAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAP2 (30516-1-AP) by Proteintech is a Polyclonal antibody targeting STAP2 in WB, ELISA applications with reactivity to human samples\n30516-1-AP targets STAP2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, LNCaP cells,  MCF-7 cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAP2, also known as BKS, belongs to the signal-transducing adaptor protein (STAP) family, The family includes STAP1 and STAP2, is a group of adaptor molecules involved in regulating multiple signaling pathways. The expression level of STAP2 in tubular cells is significantly higher than that in other renal cells, accounting for approximately 70%. In tubular epithelial cells, which are primarily affected by renal injury, STAP2 is mainly localized in the cytoplasm (PMID: 39533293).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28818 Product name: Recombinant human STAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-403 aa of BC000795 Sequence: VRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH Predict reactive species\nFull Name: signal transducing adaptor family member 2\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC000795\nGene Symbol: STAP2\nGene ID (NCBI): 55620\nRRID: AB_3086344\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UGK3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887817773225,"sku":"30516-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30516-1-ap","provider":"Iright","version":"1.0","type":"link"}