{"product_id":"proteintech-30517-1-ap","title":"Proteintech, 30517-1-AP, AK6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AK6 (30517-1-AP) by Proteintech is a Polyclonal antibody targeting AK6 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30517-1-AP targets AK6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdenylate Kinase 6 (AK6), also known as human coilin-interacting nuclear ATPase protein (hCINAP), is a unique enzyme that belongs to the adenylate kinase family. It is encoded by the AK6 gene located on chromosome 5q13.2. AK6 is a dual-activity enzyme, possessing both adenylate kinase and ATPase activities. The protein is involved in various biological processes, including gene transcription, ribosome quality control, embryonic development, cellular senescence, metabolism, proliferation, apoptosis, DNA damage response, and inflammation. It is also implicated in tumor development and has been explored as a potential drug target for cancer and neurodegenerative diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29330 Product name: Recombinant human AK6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of NM_016283.4 Sequence: MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS Predict reactive species\nFull Name: AK6\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20-24 kDa\nGenBank Accession Number: NM_016283.4\nGene Symbol: AK6\nGene ID (NCBI): 102157402\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3D8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869805957289,"sku":"30517-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30517-1-ap","provider":"Iright","version":"1.0","type":"link"}