{"product_id":"proteintech-30520-1-ap","title":"Proteintech, 30520-1-AP, Claudin 9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Claudin 9 (30520-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n30520-1-AP targets Claudin 9 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells\nPositive IHC detected in: human endometrial cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: T-47D cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClaudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium.They are small (20-27kDa)  proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. This antibody is specifically against claudin 9.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29607 Product name: Recombinant human CLDN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-217 aa of BC051870 Sequence: SLYLGWAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV Predict reactive species\nFull Name: claudin 9\nCalculated Molecular Weight: 217 aa, 23 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC051870\nGene Symbol: Claudin 9\nGene ID (NCBI): 9080\nRRID: AB_3086347\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95484\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886591987881,"sku":"30520-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30520-1-ap","provider":"Iright","version":"1.0","type":"link"}