{"product_id":"proteintech-30523-1-ap","title":"Proteintech, 30523-1-AP, IBA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IBA1 (30523-1-AP) by Proteintech is a Polyclonal antibody targeting IBA1 in IHC, IF-P, ELISA applications with reactivity to mouse, rat samples\n30523-1-AP targets IBA1 in IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: rat brain tissue, mouse brain tissue,  mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30575 Product name: Recombinant mouse AIF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 86-147 aa of NM_019467 Sequence: LKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP Predict reactive species\nFull Name: allograft inflammatory factor 1\nCalculated Molecular Weight: 17 kDa\nGenBank Accession Number: NM_019467\nGene Symbol: IBA1\nGene ID (NCBI): 11629\nRRID: AB_3086348\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O70200\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887674216617,"sku":"30523-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30523-1-ap","provider":"Iright","version":"1.0","type":"link"}