{"product_id":"proteintech-30530-1-ap","title":"Proteintech, 30530-1-AP, IDO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IDO2 (30530-1-AP) by Proteintech is a Polyclonal antibody targeting IDO2 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n30530-1-AP targets IDO2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIDO2 is one of two closely related tryptophan catabolizing enzymes induced under inflammatory conditions. In contrast to the immunoregulatory role defined for IDO1 in cancer models, IDO2 has a proinflammatory function in models of autoimmunity and contact hypersensitivity. The product of the IDO2 gene is a 420 amino-acid protein, with a molecular weight of ~47 kDa. (PMID: 34965962, PMID: 29807576, PMID: 35493480)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33013 Product name: Recombinant human IDO2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 268-420 aa of NM_194294 Sequence: GVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYHITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG Predict reactive species\nFull Name: indoleamine 2,3-dioxygenase 2\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 40-47 kDa\nGenBank Accession Number: NM_194294\nGene Symbol: IDO2\nGene ID (NCBI): 169355\nRRID: AB_3086352\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZQW0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869696544937,"sku":"30530-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30530-1-ap","provider":"Iright","version":"1.0","type":"link"}