{"product_id":"proteintech-30532-1-ap","title":"Proteintech, 30532-1-AP, Aggrecan Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Aggrecan (30532-1-AP) by Proteintech is a Polyclonal antibody targeting Aggrecan in IHC, ELISA applications with reactivity to human samples\n30532-1-AP targets Aggrecan in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: ATDC-5 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAggrecan (ACAN), also named as CSPCP, AGC1 and MSK16, belongs to the aggrecan\/versican proteoglycan family (also including versican, brevican and neurocan). It is a major component of extracellular matrix of cartilaginous tissues. A major function of aggrecan is to resist compression in cartilage. It binds avidly to hyaluronic acid via an N-terminal globular region.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32723 Product name: Recombinant human ACAN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC036445 Sequence: MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGI Predict reactive species\nFull Name: aggrecan\nCalculated Molecular Weight: 250 kDa\nGenBank Accession Number: BC036445\nGene Symbol: ACAN\nGene ID (NCBI): 176\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16112\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869805105321,"sku":"30532-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30532-1-ap","provider":"Iright","version":"1.0","type":"link"}