{"product_id":"proteintech-30545-1-ap","title":"Proteintech, 30545-1-AP, MTA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTA1 (30545-1-AP) by Proteintech is a Polyclonal antibody targeting MTA1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30545-1-AP targets MTA1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  NIH\/3T3 cells,  HEK-293T cells,  MCF-7 cells\nPositive IHC detected in: human prostate cancer tissue, human skin cancer tissue,  rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMetastasis-associated protein 1 (MTA1) is a member of the MTA family which is involved in regulating DNA-based biological processes (PMID: 25332144). MTA1 is an integral part of nucleosome remodeling histone deacetylase complex (NuRD complex)  and regulates nucleosome remodeling and deacetylation by stabilizing the NuRD complex and related proteins(PMID: 12419236). MTA1 expression is  associated with tumor malignancy in several cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30994 Product name: Recombinant human MTA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 513-678 aa of NM_004689 Sequence: TARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK Predict reactive species\nFull Name: metastasis associated 1\nCalculated Molecular Weight: 81 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: NM_004689\nGene Symbol: MTA1\nGene ID (NCBI): 9112\nRRID: AB_3086358\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13330\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869712830633,"sku":"30545-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30545-1-ap","provider":"Iright","version":"1.0","type":"link"}