{"product_id":"proteintech-30579-1-ap","title":"Proteintech, 30579-1-AP, CFAP47 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CFAP47 (30579-1-AP) by Proteintech is a Polyclonal antibody targeting CFAP47 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30579-1-AP targets CFAP47 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MRC-5 cells, human testis tissue,  mouse spermatophore tissue\nPositive IHC detected in: mouse testis tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCFAP47 (Cilia- and flagella-associated protein 47), formerly known as CXorf22, CXorf59, is located on the human chromosome X and highly expressed in the testis and encodes a cilia- and flagella-associated protein. CFAP47 was expressed in primary cilia of human kidney tubules, and knockout (KO) mice exhibited vacuolation of tubular cells and tubular dilation, providing evidence that CFAP47 is a causative gene involved in cyst formation (PMID: 33472045, 38633811). CFAP47-mutated male mice are sterile, with decreased sperm motility and abnormal flagella morphology (PMID: 37424856).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31679 Product name: Recombinant human CXorf59 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC101700 Sequence: MAIHLDKQNIILKNDKDEYLKKTRDGVLPPYQDAKPPSPASIKKTYTTSKFNDAEPAKGNLFIGVEVLPENLHLDESETSEEDHGSLEKEKYEQFLSLEEGTKAHYFFEKVVNAAQTWFSLFGWPEGPHSFSIPETIRRDVYKMQFYSSTSPPQKFSRQNDFSKYNKTIYDVLLHLSGKMPPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLNAQGGCISHVLPEFLLEPEDYKRWIEIMSSTNTMPVSSCTPKKKCSIVIEMSKFEAWSKRAWTDVFLQIYKVLVLSRVVPYCSNNMPPICVQNTPKVNPCFASSNIYSDSERILLSWMNINYENTRHVIWKNCHKDVI Predict reactive species\nFull Name: chromosome X open reading frame 59\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC101700\nGene Symbol: CXorf59\nGene ID (NCBI): 286464\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZTR5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886490701993,"sku":"30579-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30579-1-ap","provider":"Iright","version":"1.0","type":"link"}